PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_82060g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SAP
Protein Properties Length: 462aa    MW: 50691.5 Da    PI: 5.7874
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_82060g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP125.36e-393917526153
            SAP  26 s..........gesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravsrsdllwqrltrriWrrtkllrdtW 111
                    +           e++ +++ r+ +  +vwpePf+eala+ va++a+r  G la  +a++nvfqvc twravs s++lw+ l + +W+++++  + W
  MA_82060g0010  39 EfsarrsrarsHETDVSQEARNDQNGGVWPEPFIEALAQAVALEAARCGGALAVGPAVVNVFQVCCTWRAVSHSEMLWKALMHSVWDQNDRQSESW 134
                    033344444335666667777778889********************************************************************* PP

            SAP 112 reeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsC 153
                    r+ yi  hrta+nfr +r +y   ++d ++ +++ + +   C
  MA_82060g0010 135 RNRYIRLHRTASNFRYNRAKYAAIEYDVSSDSNS-NGNGTAC 175
                    ***************************9855554.4455555 PP

2SAP233.87.3e-72178460181452
            SAP 181 lhvstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaet 276
                      ++t+++  ++rlG +s+a++Giv+ + ++vfa++ G i+v  i     +  r a+ G+v +dG+lvdf+G++rWwvGlyaG++G+a hiWda t
  MA_82060g0010 178 ECIRTMRAGDQNRLGSLSQAIAGIVLHQDKVVFASFYGSIFVGSISR---GDVRCAHPGNVRDDGTLVDFTGCDRWWVGLYAGISGHACHIWDAGT 270
                    5689*****************************************98...689******************************************* PP

            SAP 277 eelvfvGGsltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrve 372
                    eelvf GG +tdP+a++GW mlte +e +Grv++ ++   +  t+l++   ++        eee+  G+iv s+d++ + ++++ + G+a+vr++ 
  MA_82060g0010 271 EELVFNGGGITDPDALRGWRMLTEQAERIGRVKLGGNGLLLLATRLKMKKKQMMGWIPFTDEEETDDGIIVESVDVNRDRFLAASNDGNARVRKIR 366
                    ************************************************999998888888888888****************************** PP

            SAP 373 nleevcrfrvrg...............aqrgvlgCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavsssdgtihlldf 452
                     le+vc f   g                 r++lg +n+  a +++ gv+ +W+ ++ +  ly l e+vg+v  lv dd hvav++ d+ ihl+ f
  MA_82060g0010 367 ALENVCAFPFDGlggaddhssgsnnnnNYRKILGTLNTWLAFICIDGVVHAWDADSGA-RLYRLVEQVGDVFDLVGDDEHVAVCAVDNGIHLWSF 460
                    ********76432222211111222334699************************977.99********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF813836.32E-796144IPR001810F-box domain
Gene3DG3DSA:1.20.1280.506.4E-797152No hitNo description
Gene3DG3DSA:2.130.10.109.7E-10176277IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509781.28E-10197277IPR017986WD40-repeat-containing domain
SuperFamilySSF509781.28E-10335461IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.109.7E-10335460IPR015943WD40/YVTN repeat-like-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MSSQVPGSEK GQGASAQTLA QEEGEIPVER GGYSGERGEF SARRSRARSH ETDVSQEARN  60
DQNGGVWPEP FIEALAQAVA LEAARCGGAL AVGPAVVNVF QVCCTWRAVS HSEMLWKALM  120
HSVWDQNDRQ SESWRNRYIR LHRTASNFRY NRAKYAAIEY DVSSDSNSNG NGTACSKECI  180
RTMRAGDQNR LGSLSQAIAG IVLHQDKVVF ASFYGSIFVG SISRGDVRCA HPGNVRDDGT  240
LVDFTGCDRW WVGLYAGISG HACHIWDAGT EELVFNGGGI TDPDALRGWR MLTEQAERIG  300
RVKLGGNGLL LLATRLKMKK KQMMGWIPFT DEEETDDGII VESVDVNRDR FLAASNDGNA  360
RVRKIRALEN VCAFPFDGLG GADDHSSGSN NNNNYRKILG TLNTWLAFIC IDGVVHAWDA  420
DSGARLYRLV EQVGDVFDLV GDDEHVAVCA VDNGIHLWSF RP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1241891e-167BT124189.1 Picea sitchensis clone WS04720_I09 unknown mRNA.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9756912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.14e-80SAP family protein